Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3)

This Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Bombesin receptor subtype-3, BRS-3

UniProt

Q6H2Y3

Expression Region

1-398

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRQPHSPNQTLISITNDTESSSVVSNDNTNKGRSGDNSPGIEALCAIYITYAVIISVG ILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCK VLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCIKAGCVWIVSMIFALP EAIFSNVYSFRDPNKNVTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIA RTLYKSTLNIPTEEQGHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTY VDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKTFQKHFKAQLFCCKAEQPEPPVADTS LTTLAVMGRVPGTGNMQMSEISVTSFPGCSVKQAEDRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Synaptotagmin-6 (SYT6) ELISA Kit
KTE70307-01 48 Tests

Mouse Synaptotagmin-6 (SYT6) ELISA Kit

Sign In for Pricing
View Details
Mouse Synaptotagmin-6 (SYT6) ELISA Kit
KTE70307-02 96 Tests

Mouse Synaptotagmin-6 (SYT6) ELISA Kit

Sign In for Pricing
View Details
Mouse Synaptotagmin-6 (SYT6) ELISA Kit
KTE70307-03 5x 96 Tests

Mouse Synaptotagmin-6 (SYT6) ELISA Kit

Sign In for Pricing
View Details
Mouse Synaptotagmin-6 (SYT6) ELISA Kit
KTE70307-04 50x 96 Tests

Mouse Synaptotagmin-6 (SYT6) ELISA Kit

Sign In for Pricing
View Details
Human EPOP Pre-designed siRNA Set A
SI005055A 1 Each

Human EPOP Pre-designed siRNA Set A

Sign In for Pricing
View Details
Tissue Polypeptide Specific Antigen (TPS) BioAssayTM ELISA Kit (Human)
028459-01 48 Tests

Tissue Polypeptide Specific Antigen (TPS) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details