Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-3 adrenergic receptor (ADRB3)

This Recombinant Cat Beta-3 adrenergic receptor (ADRB3) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

Q9TST4

Expression Region

1-398

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPHGNGSLASWPDAPTLTPNTANTSGLPGVPWAVALAGALLALAVLATVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGHWPLGATGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPHCCAFASNIPYALLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRG ELGRFPPGESPPAASRSMSPAPAGPCASPAGVPSYGRRPARLLPLREHRALRTLGLIMGT FSLCWLPFFVANVVRALGGPSLVPSPAFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL CRCRLEERHAAASGAGETSDAPAALTRPAESGLPGGIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3, Phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, H
MBS6480654-01 0.2 mL

Histone H3, Phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, H

Sign In for Pricing
View Details
Histone H3, Phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, H
MBS6480654-02 5x 0.2 mL

Histone H3, Phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, H

Sign In for Pricing
View Details
Fenthoxon Sulfone (Dimethylphosphate-d6)
450016-01 1 mg

Fenthoxon Sulfone (Dimethylphosphate-d6)

Sign In for Pricing
View Details
Fenthoxon Sulfone (Dimethylphosphate-d6)
450016-02 2.5 mg

Fenthoxon Sulfone (Dimethylphosphate-d6)

Sign In for Pricing
View Details
MPEG10-OH (2,5,8,11,14,17,20,23,26,29-Decaoxahentriacontan-31-ol)
516879 1 g

MPEG10-OH (2,5,8,11,14,17,20,23,26,29-Decaoxahentriacontan-31-ol)

Sign In for Pricing
View Details
Chicken Polyclonal ATG5 Antibody [Alexa Fluor 700]
NBP1-76992AF700 0.1 mL

Chicken Polyclonal ATG5 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details