Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-3 adrenergic receptor (ADRB3)

This Recombinant Cat Beta-3 adrenergic receptor (ADRB3) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

Q9TST4

Expression Region

1-398

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPHGNGSLASWPDAPTLTPNTANTSGLPGVPWAVALAGALLALAVLATVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGHWPLGATGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPHCCAFASNIPYALLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRG ELGRFPPGESPPAASRSMSPAPAGPCASPAGVPSYGRRPARLLPLREHRALRTLGLIMGT FSLCWLPFFVANVVRALGGPSLVPSPAFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL CRCRLEERHAAASGAGETSDAPAALTRPAESGLPGGIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Antibody
abx103989-01 100 µL

B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Antibody

Sign In for Pricing
View Details
B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Antibody
abx103989-02 200 µL

B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Antibody

Sign In for Pricing
View Details
B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Antibody
abx103989-03 1 mL

B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Antibody

Sign In for Pricing
View Details
SSR1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV749598 1.0 µg DNA

SSR1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Olfr279 siRNA Oligos set (Mouse)
33030174 3x 5 nmol

Olfr279 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Danio rerio Charged multivesicular body protein 4b (chmp4b)
MBS1410212-01 0.02 mg (E-Coli)

Recombinant Danio rerio Charged multivesicular body protein 4b (chmp4b)

Sign In for Pricing
View Details