Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mu-type opioid receptor (Oprm1)

This Recombinant Rat Mu-type opioid receptor (Oprm1) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Mu-type opioid receptor, M-OR-1, MOR-1, Opioid receptor B

UniProt

P33535

Expression Region

1-398

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8- Chloro-2'-O- (fluoresceindiacetate- (2-aminoethylcarbamoyl) ) adenosine-3', 5'-cyclic monophosphate (8-Cl-2'-FDA-AEC-cAMP)
C 113 1 Each

8- Chloro-2'-O- (fluoresceindiacetate- (2-aminoethylcarbamoyl) ) adenosine-3', 5'-cyclic monophosphate (8-Cl-2'-FDA-AEC-cAMP)

Sign In for Pricing
View Details
Human GNRHR Knockout HEK293T cell line
GTR15410838 1 Vial

Human GNRHR Knockout HEK293T cell line

Sign In for Pricing
View Details
NOD1 ELISA Kit (Mouse) (OKEH08040)
OKEH08040 96 Well

NOD1 ELISA Kit (Mouse) (OKEH08040)

Sign In for Pricing
View Details
MGMT Rabbit pAb
MBS8575638-01 0.1 mL

MGMT Rabbit pAb

Sign In for Pricing
View Details
MGMT Rabbit pAb
MBS8575638-02 0.1 mL (AF405L)

MGMT Rabbit pAb

Sign In for Pricing
View Details
MGMT Rabbit pAb
MBS8575638-03 0.1 mL (AF405S)

MGMT Rabbit pAb

Sign In for Pricing
View Details