Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Substance-K receptor (TACR2)

This Recombinant Human Substance-K receptor (TACR2) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P21452

Expression Region

1-398

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EHF activation kit by CRISPRa
GA108853 1 Kit

Human EHF activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF405S conjugate, 0.1mg/mL
BNC041198-100 1x 100 µL

Cytokeratin 7 (KRT7/1198), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SNRPD3 Antibody
RC-4680-01 50 μL

Recombinant SNRPD3 Antibody

Sign In for Pricing
View Details
Recombinant SNRPD3 Antibody
RC-4680-02 100 µL

Recombinant SNRPD3 Antibody

Sign In for Pricing
View Details
Recombinant SNRPD3 Antibody
RC-4680-03 1 mL

Recombinant SNRPD3 Antibody

Sign In for Pricing
View Details
Human IFT80 activation kit by CRISPRa
GA111589 1 Kit

Human IFT80 activation kit by CRISPRa

Sign In for Pricing
View Details