Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mizuhopecten yessoensis Rhodopsin, G0-coupled (SCOP2)

This Recombinant Mizuhopecten yessoensis Rhodopsin, G0-coupled (SCOP2) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Rhodopsin, G0-coupled, G0-rhodopsin

UniProt

O15974

Expression Region

1-399

Origin

Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFPLNRTDTALVISPSEFRIIGIFISICCIIGVLGNLLIIIVFAKRRSVRRPINFFVLN LAVSDLIVALLGYPMTAASAFSNRWIFDNIGCKIYAFLCFNSGVISIMTHAALSFCRYII ICQYGYRKKITQTTVLRTLFSIWSFAMFWTLSPLFGWSSYVIEVVPVSCSVNWYGHGLGD VSYTISVIVAVYVFPLSIIVFSYGMILQEKVCKDSRKNGIRAQQRYTPRFIQDIEQRVTF ISFLMMAAFMVAWTPYAIMSALAIGSFNVENSFAALPTLFAKASCAYNPFIYAFTNANFR DTVVEIMAPWTTRRVGVSTLPWPQVTYYPRRRTSAVNTTDIEFPDDNIFIVNSSVNGPTV KREKIVQRNPINVRLGIKIEPRDSRAATENTFTADFSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-500 1x 500 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL
BNC680904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (CDK1/873), CF647 conjugate, 0.1mg/mL
BNC470873-100 1x 100 µL

P34 / cdk1 (CDK1/873), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2421), CF594 conjugate, 0.1mg/mL
BNC942421-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2421), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details