Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bombesin receptor subtype-3 (BRS3)

This Recombinant Human Bombesin receptor subtype-3 (BRS3) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Bombesin receptor subtype-3, BRS-3

UniProt

P32247

Expression Region

1-399

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP2 polyclonal antibody
BS72289-01 50 µL

MMP2 polyclonal antibody

Sign In for Pricing
View Details
MMP2 polyclonal antibody
BS72289-02 100 µL

MMP2 polyclonal antibody

Sign In for Pricing
View Details
Cpsf4 (BC057067) Mouse Tagged Lenti ORF Clone
MR201225L3 10 µg

Cpsf4 (BC057067) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FOXB2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-16161R-APC-Cy5.5 100 µL

FOXB2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Adamts2 Rat shRNA Plasmid (Locus ID 287899)
TL709063 1 Kit

Adamts2 Rat shRNA Plasmid (Locus ID 287899)

Sign In for Pricing
View Details
Wnt16 Recombinant Antibody
bsm-62620R-01 20 µL

Wnt16 Recombinant Antibody

Sign In for Pricing
View Details