Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bombesin receptor subtype-3 (BRS3)

This Recombinant Human Bombesin receptor subtype-3 (BRS3) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Bombesin receptor subtype-3, BRS-3

UniProt

P32247

Expression Region

1-399

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jhdm-1 Antibody
orb800781 2 mg

Jhdm-1 Antibody

Sign In for Pricing
View Details
Recombinant Human ART4 protein (GST,His tag)
MBS2580718-01 0.02 mg

Recombinant Human ART4 protein (GST,His tag)

Sign In for Pricing
View Details
Recombinant Human ART4 protein (GST,His tag)
MBS2580718-02 0.1 mg

Recombinant Human ART4 protein (GST,His tag)

Sign In for Pricing
View Details
Recombinant Human ART4 protein (GST,His tag)
MBS2580718-03 5x 0.1 mg

Recombinant Human ART4 protein (GST,His tag)

Sign In for Pricing
View Details
Human NSE (Neuron-specific Enolase) ELISA Kit
orb1715094-01 48 Tests

Human NSE (Neuron-specific Enolase) ELISA Kit

Sign In for Pricing
View Details
Human NSE (Neuron-specific Enolase) ELISA Kit
orb1715094-02 96 Tests

Human NSE (Neuron-specific Enolase) ELISA Kit

Sign In for Pricing
View Details