Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorocebus aethiops D (3) dopamine receptor

This Recombinant Chlorocebus aethiops D (3) dopamine receptor spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P52703

Expression Region

1-400

Origin

Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQLSGHLNYTCGVENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRVCCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVTLMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDRAHLELKRYYSICQDTALGGPGFQERGGELKREERTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL12/SDF1 Polyclonal Antibody
E-AB-40578-01 25 µL

CXCL12/SDF1 Polyclonal Antibody

Sign In for Pricing
View Details
CXCL12/SDF1 Polyclonal Antibody
E-AB-40578-02 100 µL

CXCL12/SDF1 Polyclonal Antibody

Sign In for Pricing
View Details
MACC1 (NM_182762) Human Recombinant Protein
TP324774M 100 µg

MACC1 (NM_182762) Human Recombinant Protein

Sign In for Pricing
View Details
Aif1l Mouse Gene Knockout Kit (CRISPR)
KN501037 1 Kit

Aif1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB640218 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Recombinant Anti-Ubiquitin (linkage-specific K63) Antibody
RC-5966-01 50 μL

Recombinant Anti-Ubiquitin (linkage-specific K63) Antibody

Sign In for Pricing
View Details