Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorocebus aethiops D (3) dopamine receptor

This Recombinant Chlorocebus aethiops D (3) dopamine receptor spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P52703

Expression Region

1-400

Origin

Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQLSGHLNYTCGVENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRVCCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVTLMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDRAHLELKRYYSICQDTALGGPGFQERGGELKREERTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK1/2/3/4 (Ab-215) Antibody
8B1093-AAT 50 µg

MARK1/2/3/4 (Ab-215) Antibody

Sign In for Pricing
View Details
Mouse Akt1 activation kit by CRISPRa
GA200150 1 Kit

Mouse Akt1 activation kit by CRISPRa

Sign In for Pricing
View Details
PE Anti-Mouse CD31 Antibody[390]
E-AB-F1180D-01 50 Tests

PE Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE Anti-Mouse CD31 Antibody[390]
E-AB-F1180D-02 100 Tests

PE Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE Anti-Mouse CD31 Antibody[390]
E-AB-F1180D-03 2x 100 Tests

PE Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
FLJ12331 (NM_024986) Human Recombinant Protein
TP760310 50 µg

FLJ12331 (NM_024986) Human Recombinant Protein

Sign In for Pricing
View Details