Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes D (3) dopamine receptor (DRD3)

This Recombinant Pan troglodytes D (3) dopamine receptor (DRD3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

Q5IS72

Expression Region

1-400

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYMVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF640R conjugate, 0.1mg/mL
BNC402295-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PAX9 activation kit by CRISPRa
GA103397 1 Kit

Human PAX9 activation kit by CRISPRa

Sign In for Pricing
View Details
SMARCD1 (NM_003076) Human Over-expression Lysate
LC401074 20 µg

SMARCD1 (NM_003076) Human Over-expression Lysate

Sign In for Pricing
View Details
ETS1 (Marker of Tumor Metastasis) (ETS1/1801), 0.2mg/mL
BNUB1801-500 1x 500 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), 0.2mg/mL

Sign In for Pricing
View Details
Suppressor of Fused (SUFU) (NM_016169) Human Over-expression Lysate
LC402511 20 µg

Suppressor of Fused (SUFU) (NM_016169) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Hydroxyindole O-b-D-Glucuronide Sodium Salt
TRC-H943443-2.5MG 2.5 mg

4-Hydroxyindole O-b-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details