Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes D (3) dopamine receptor (DRD3)

This Recombinant Pan troglodytes D (3) dopamine receptor (DRD3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

Q5IS72

Expression Region

1-400

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYMVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM78B activation kit by CRISPRa
GA115703 1 Kit

Human FAM78B activation kit by CRISPRa

Sign In for Pricing
View Details
GNB3 (NM_002075) Human Over-expression Lysate
LC400761 20 µg

GNB3 (NM_002075) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), CF640R conjugate, 0.1mg/mL
BNC402610-500 1x 500 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Breast
CP541360 150 µg

Tissue Protein Lysate, Breast

Sign In for Pricing
View Details
Human TMEM114 activation kit by CRISPRa
GA117074 1 Kit

Human TMEM114 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human RAGE protein (N-His)
PKSH034181-01 20 µg

Recombinant Human RAGE protein (N-His)

Sign In for Pricing
View Details