Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Opsin-3 (Opn3)

This Recombinant Mouse Opsin-3 (Opn3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Opsin-3, Encephalopsin, Panopsin

UniProt

Q9WUK7

Expression Region

1-400

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSGNRSGDQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLV LLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGS LFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILD IHGLGCTVDWRSKDANDSSFVLFLFLGCLVVPVGIIAHCYGHILYSVRMLRCVEDLQTIQ VIKMLRYEKKVAKMCFLMAFVFLTCWMPYIVTRFLVVNGYGHLVTPTVSIVSYLFAKSST VYNPVIYIFMNRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMHIRPIVMSQKDGDRPKK KVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For NAD (P)H-hydrate epimerase
E10478b 96 Tests

ELISA Kit For NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details
Recombinant Nectria haematococca Vacuolar protein sorting/targeting protein 10 (VPS10), partial
MBS1027448-01 1 mg (E-Coli)

Recombinant Nectria haematococca Vacuolar protein sorting/targeting protein 10 (VPS10), partial

Sign In for Pricing
View Details
Recombinant Nectria haematococca Vacuolar protein sorting/targeting protein 10 (VPS10), partial
MBS1027448-02 1 mg (Yeast)

Recombinant Nectria haematococca Vacuolar protein sorting/targeting protein 10 (VPS10), partial

Sign In for Pricing
View Details
C9orf78 antibody
orb74249 100 µL

C9orf78 antibody

Sign In for Pricing
View Details
Rat Free Fatty Acid ELISA Kit
MBS733451-01 48 Well

Rat Free Fatty Acid ELISA Kit

Sign In for Pricing
View Details
Rat Free Fatty Acid ELISA Kit
MBS733451-02 96 Well

Rat Free Fatty Acid ELISA Kit

Sign In for Pricing
View Details