Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-3 adrenergic receptor (Adrb3)

This Recombinant Mouse Beta-3 adrenergic receptor (Adrb3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

P25962

Expression Region

1-400

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPHRNGSLALWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVIIAIA RTPRLQTITNVFVTSLAAADLVVGLLVMPPGATLALTGHWPLGETGCELWTSVDVLCVTA SIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSAAVSFAPIMSQWWRVGAD AEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRHLLRRELG RFSPEESPPSPSRSPSPATGGTPAAPDGVPPCGRRPARLLPLREHRALRTLGLIMGIFSL CWLPFFLANVLRALAGPSLVPSGVFIALNWLGYANSAFNPVIYCRSPDFRDAFRRLLCSY GGRGPEEPRAVTFPASPVEARQSPPLNRFDGYEGARPFPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT10 3'UTR Luciferase Stable Cell Line
TU015246 1.0 mL

NAT10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD53 (TSPAN25) Mouse Monoclonal Antibody
MBS439082-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD53 (TSPAN25) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD53 (TSPAN25) Mouse Monoclonal Antibody
MBS439082-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD53 (TSPAN25) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD53 (TSPAN25) Mouse Monoclonal Antibody
MBS439082-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD53 (TSPAN25) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD53 (TSPAN25) Mouse Monoclonal Antibody
MBS439082-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD53 (TSPAN25) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD53 (TSPAN25) Mouse Monoclonal Antibody
MBS439082-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

CD53 (TSPAN25) Mouse Monoclonal Antibody

Sign In for Pricing
View Details