Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (3) dopamine receptor (DRD3)

This Recombinant Human D (3) dopamine receptor (DRD3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P35462

Expression Region

1-400

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caprine Adipose Stem Cells
CC12L888 5x 10^5 Cells/Vial

Caprine Adipose Stem Cells

Sign In for Pricing
View Details
Rabbit Anti-CD32 antibody
SLM-60674R-01 50 µL

Rabbit Anti-CD32 antibody

Sign In for Pricing
View Details
Rabbit Anti-CD32 antibody
SLM-60674R-02 100 µL

Rabbit Anti-CD32 antibody

Sign In for Pricing
View Details
Mouse Peroxisome Proliferator-activated receptor Gamma, PPAR-γ ELISA Kit
SL0433Mo-01 48 Tests

Mouse Peroxisome Proliferator-activated receptor Gamma, PPAR-γ ELISA Kit

Sign In for Pricing
View Details
Mouse Peroxisome Proliferator-activated receptor Gamma, PPAR-γ ELISA Kit
SL0433Mo-02 96 Tests

Mouse Peroxisome Proliferator-activated receptor Gamma, PPAR-γ ELISA Kit

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf8 (wtf8)
MBS7033649-01 0.02 mg

Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf8 (wtf8)

Sign In for Pricing
View Details