Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (3) dopamine receptor (DRD3)

This Recombinant Human D (3) dopamine receptor (DRD3) spans the amino acid sequence from region 1-400.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P35462

Expression Region

1-400

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP4-12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1182308 1.0 µg DNA

KRTAP4-12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) S RBD (K417N, E484K, N501Y) Protein
orb1290148-01 50 mg

SARS-CoV-2 (2019-nCoV) S RBD (K417N, E484K, N501Y) Protein

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) S RBD (K417N, E484K, N501Y) Protein
orb1290148-02 100 mg

SARS-CoV-2 (2019-nCoV) S RBD (K417N, E484K, N501Y) Protein

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) S RBD (K417N, E484K, N501Y) Protein
orb1290148-03 1 mg

SARS-CoV-2 (2019-nCoV) S RBD (K417N, E484K, N501Y) Protein

Sign In for Pricing
View Details
RNH1 (Ribonuclease Inhibitor, Placental Ribonuclease Inhibitor, Placental RNase Inhibitor, Ribonuclease/Angiogenin Inhibitor 1, RAI, PRI, RNH) (AP) discontinued
132707-AP 100 µL

RNH1 (Ribonuclease Inhibitor, Placental Ribonuclease Inhibitor, Placental RNase Inhibitor, Ribonuclease/Angiogenin Inhibitor 1, RAI, PRI, RNH) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni thrB Protein (aa 1-292) (strain 81116 / NCTC 11828)
VAng-Ly2457-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni thrB Protein (aa 1-292) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details