Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 117 (tmem117)

This Recombinant Danio rerio Transmembrane protein 117 (tmem117) spans the amino acid sequence from region 1-401.

Product Specifications

Product Name Alternative

Transmembrane protein 117

UniProt

Q7ZVW1

Expression Region

1-401

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSQSLHDCLRGRCLGVLRRMEIIGRFRYYFQHPWSRLLVSYLVTFFNFLIFAEDPVSHS QKEAHMSVVGNCFSFIISKYPAGFWSVLKVLLWVLAIICGLIAGKFIFHRRLFGRVLRLK MFREDHGSWMTMFFSTILSLFIFSHIYNLLLLMSVRMRPYMVTEYMGIRNESFMKMAAVG TWMGDFVTAWMVTDMMLQDTHYPDWGRTARHLWRQGHNRIVLFWTVLICLTSVVVLVIST DWIRWDNLNRGFLPSDEVSRAFLASFILVFDLLIVMQDWEFPHFMGDLDMNLPGLSTTQL KIRLPVCKRIFKEEYHIHITGKWFNYGIIFLVLILDLNMWKNQIFYKPYEYGQYVGPGEK IYTVEDPDTLQDFNRSMLTWEWRSTNIDPRTNQTFNQSNAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details