Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Prostaglandin D2 receptor 2 (Ptgdr2)

This Recombinant Rat Prostaglandin D2 receptor 2 (Ptgdr2) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Prostaglandin D2 receptor 2, G protein-coupled receptor 44

UniProt

Q6XKD3

Expression Region

1-403

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANITLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL LSAISLDRCLQVVRPVWAQNHRTVAAAHRVCLMLWALAVLNTVPYFVFRDTIPRRDGRIM CYYNMLLLNPGSDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLQLHHRGRQRT GRFVRLVAAIVVAFILCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP LLYVLTCPDMLHKLRRSLLTVLESVLVEDSDLSTGPGKRCRRRHRRRASSTTTPASTLLL ADRFPQLRPARLIGWMRRGSAELPRRVREQSQEKQGSLSCTLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-500 1x 500 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL
BNC430999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL
BNC682312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details