Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative odorant receptor 67c (Or67c)

This Recombinant Drosophila melanogaster Putative odorant receptor 67c (Or67c) spans the amino acid sequence from region 1-404.

Product Specifications

Product Name Alternative

Putative odorant receptor 67c

UniProt

Q9VT90

Expression Region

1-404

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METAKDNTARTFMELMRVPVQFYRTIGEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLVI GELVFFYNSIQDFETIRLAIAVAPCIGFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKT LAKQMEYKLPDFEKTMKRVINIFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGF LIWFPFDATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLED HPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTE STVEVIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLL IMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFALLRTTYSNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF647 conjugate, 0.1mg/mL
BNC471029-500 1x 500 µL

CD47 (IAP/964 + B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF647 conjugate, 0.1mg/mL
BNC472197-100 1x 100 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details