Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhomboid-related protein 3 (Rhbdl3)

This Recombinant Mouse Rhomboid-related protein 3 (Rhbdl3) spans the amino acid sequence from region 1-404.

Product Specifications

Product Name Alternative

Rhomboid-related protein 3, EC= 3.4.21.105, Ventrhoid transmembrane protein

UniProt

P58873

Expression Region

1-404

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFR SLLESHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSS KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYN GVLLDQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVP LEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMK CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRN YEQRLQDQSLWWIFVTMYTIFVLFAVFWNIFAYTLLDLKLPPAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAM9B shRNA (UAS) - Lentiviral human FAM9B shRNA (UAS, GFP) plasmid
GTR15345817 1 Vial

Lentiviral human FAM9B shRNA (UAS) - Lentiviral human FAM9B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Calretinin,CR ELISA Kit
CN-03978H1 96T

Human Calretinin,CR ELISA Kit

Sign In for Pricing
View Details
RPL29P12 sgRNA CRISPR Lentivector (Human) (Target 1)
K1956302 1.0 µg DNA

RPL29P12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-IDI1 Antibody Picoband® (Dylight488 Conjugate)
A07892-1-Dylight488 100 µg

Anti-IDI1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (MaxLight 550)
MBS6218007-01 0.1 mL

MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (MaxLight 550)

Sign In for Pricing
View Details
MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (MaxLight 550)
MBS6218007-02 5x 0.1 mL

MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (MaxLight 550)

Sign In for Pricing
View Details