Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Beta-3 adrenergic receptor (ADRB3)

This Recombinant Sheep Beta-3 adrenergic receptor (ADRB3) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

Q9XT58

Expression Region

1-405

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPPGNSSLTPWPDIPTLAPNTANASGLPGVPWAVALAGALLALAVLATVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGHWPLGVTGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPRCCTFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRR ELGRFPPEESPPAPSRSGSPGPAGPYASPAGVPSYGRRPARLLPLREHRALRTLGLIMGT FTLCWLPFFVVNVVRALGGPSLVSGPTFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL CRCPPEEHLAAASPPRAPSGAPTVLTSPAGPRQPSPLDGASCGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His
bs-106150P-01 20 µg

Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His
bs-106150P-02 50 µg

Recombinant Mouse ELANE/Neutrophil elastase Protein, N-His

Sign In for Pricing
View Details
Cdk4 siRNA Oligos set (Rat)
15704176 3x 5 nmol

Cdk4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC25A44 Antibody
NBP2-56950 100 µL

Rabbit Polyclonal SLC25A44 Antibody

Sign In for Pricing
View Details
Ro 10-5824 dihydrochloride
B7019-100 100 mg

Ro 10-5824 dihydrochloride

Sign In for Pricing
View Details
Hsp90 beta Rabbit mAb
MBS4753306-01 0.1 mL

Hsp90 beta Rabbit mAb

Sign In for Pricing
View Details