Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Beta-3 adrenergic receptor (ADRB3)

This Recombinant Sheep Beta-3 adrenergic receptor (ADRB3) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

Q9XT58

Expression Region

1-405

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPPGNSSLTPWPDIPTLAPNTANASGLPGVPWAVALAGALLALAVLATVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGHWPLGVTGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPRCCTFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRR ELGRFPPEESPPAPSRSGSPGPAGPYASPAGVPSYGRRPARLLPLREHRALRTLGLIMGT FTLCWLPFFVVNVVRALGGPSLVSGPTFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL CRCPPEEHLAAASPPRAPSGAPTVLTSPAGPRQPSPLDGASCGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a32 3'UTR Luciferase Stable Cell Line
TU220538 1.0 mL

Slc25a32 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CDAN1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7994R-BF488 100 µL

CDAN1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans ZK1320.3 Polyclonal Antibody
MBS7195192 Inquire

Rabbit anti-Caenorhabditis elegans ZK1320.3 Polyclonal Antibody

Sign In for Pricing
View Details
Prps2 3'UTR Luciferase Stable Cell Line
TU216869 1.0 mL

Prps2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PIK3IP1 Polyclonal Antibody
E-AB-92307-01 60 µL

PIK3IP1 Polyclonal Antibody

Sign In for Pricing
View Details
PIK3IP1 Polyclonal Antibody
E-AB-92307-02 120 µL

PIK3IP1 Polyclonal Antibody

Sign In for Pricing
View Details