Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 143 (Gpr143)

This Recombinant Mouse G-protein coupled receptor 143 (Gpr143) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

G-protein coupled receptor 143, MOA1, Ocular albinism type 1 protein homolog

UniProt

P70259

Expression Region

1-405

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPRLGIFCCPTWDAATQLVLSFQPRVFHALCLGSGTLRLVLGLLQLLSGRRSVGHRAP ATSPAASVHILRAATACDLLGCLGIVIRSTVWIAYPEFIENISNVNATDIWPATFCVGSA MWIQLLYSACFWWLFCYAVDVYLVIRRSAGRSTILLYHIMAWGLAVLLCVEGAVMLYYPS VSRCERGLDHAIPHYVTTYLPLLLVLVANPILFHKTVTSVASLLKGRKGVYTENERLMGA VIKTRFFKIMLVLIACWLSNIINESLLFYLEMQPDIHGGSLKRIQNAARTTWFIMGILNP AQGLLLSLAFYGWTGCSLDVHPPKMVIQWETMTASAAEGTYQTPVRSCVPHQNPRKVVCV GGHTSDEVLSILSEDSDASTVEIHTATGSCNIKEVDSISQAQGEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rerg Mouse Gene Knockout Kit (CRISPR)
KN514672 1 Kit

Rerg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
14-3-3 θ/τ (Ab-232) Antibody
8B0758-AAT 50 µg

14-3-3 θ/τ (Ab-232) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS634471 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
GelRed® Nucleic Acid Gel Stain 10.000X in DMSO
#41002 1x 500 µL

GelRed® Nucleic Acid Gel Stain 10.000X in DMSO

Sign In for Pricing
View Details
Mrpl36 (NM_053163) Mouse Tagged ORF Clone
MG200328 10 µg

Mrpl36 (NM_053163) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: sigmoid
CD564745 5 µg

Tissue Genomic DNA, Colon: sigmoid

Sign In for Pricing
View Details