Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 143 (Gpr143)

This Recombinant Mouse G-protein coupled receptor 143 (Gpr143) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

G-protein coupled receptor 143, MOA1, Ocular albinism type 1 protein homolog

UniProt

P70259

Expression Region

1-405

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPRLGIFCCPTWDAATQLVLSFQPRVFHALCLGSGTLRLVLGLLQLLSGRRSVGHRAP ATSPAASVHILRAATACDLLGCLGIVIRSTVWIAYPEFIENISNVNATDIWPATFCVGSA MWIQLLYSACFWWLFCYAVDVYLVIRRSAGRSTILLYHIMAWGLAVLLCVEGAVMLYYPS VSRCERGLDHAIPHYVTTYLPLLLVLVANPILFHKTVTSVASLLKGRKGVYTENERLMGA VIKTRFFKIMLVLIACWLSNIINESLLFYLEMQPDIHGGSLKRIQNAARTTWFIMGILNP AQGLLLSLAFYGWTGCSLDVHPPKMVIQWETMTASAAEGTYQTPVRSCVPHQNPRKVVCV GGHTSDEVLSILSEDSDASTVEIHTATGSCNIKEVDSISQAQGEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF513 activation kit by CRISPRa
GA115117 1 Kit

Human ZNF513 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl 2-((1R,4R)-4-((tert-Butoxycarbonyl)amino)cyclohexyl)acetate
TRC-E662855-2.5G 2.5 g

Ethyl 2-((1R,4R)-4-((tert-Butoxycarbonyl)amino)cyclohexyl)acetate

Sign In for Pricing
View Details
SOCS2 (NM_003877) Human Over-expression Lysate
LC401278 20 µg

SOCS2 (NM_003877) Human Over-expression Lysate

Sign In for Pricing
View Details
SYNC (NM_001161708) Human Over-expression Lysate
LY431422 100 µg

SYNC (NM_001161708) Human Over-expression Lysate

Sign In for Pricing
View Details
ILF2 Human Gene Knockout Kit (CRISPR)
KN401751 1 Kit

ILF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACCN1 (ASIC2) (NM_001094) Human Recombinant Protein
TP310409 20 µg

ACCN1 (ASIC2) (NM_001094) Human Recombinant Protein

Sign In for Pricing
View Details