Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Beta-3 adrenergic receptor (ADRB3)

This Recombinant Dog Beta-3 adrenergic receptor (ADRB3) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

Beta-3 adrenergic receptor, Beta-3 adrenoreceptor, Beta-3 adrenoceptor

UniProt

O02662

Expression Region

1-405

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWPHGNGSVASWPAAPTPTPDAANTSGLPGAPWAVALAGALLALEVLATVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGRWPLGATGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPHCCAFASNIPYALLSSSVSFYLPLLVMLFVYARVFLVATRQLRLLRR ELGRFPPAESPPAASRSRSPGPARRCASPAAVPSDRLRPARLLPLREHRALRTLGLIVGT FTLCWLPFFVANVMRALGGPSLVPSPALLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL CRCRREEHRAAASPPGDPSAAPAALTSPAESSRCQALDGASWGIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRBP2 (D7C8K) Rabbit Monoclonal Antibody
CST 62043S 100 µL

TRBP2 (D7C8K) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DUSP15 (NM_177991) Human Over-expression Lysate
LH15643V 100 µg

DUSP15 (NM_177991) Human Over-expression Lysate

Sign In for Pricing
View Details
RNPC3 (RNA-Binding Protein 40, RNA-Binding Region (RNP1, RRM) Containing 3)
490736 100 µL

RNPC3 (RNA-Binding Protein 40, RNA-Binding Region (RNP1, RRM) Containing 3)

Sign In for Pricing
View Details
Human DHX29 siRNA
abx914122-01 15 nmol

Human DHX29 siRNA

Sign In for Pricing
View Details
Human DHX29 siRNA
abx914122-02 30 nmol

Human DHX29 siRNA

Sign In for Pricing
View Details
CPNE9 Protein Vector (Rat) (pPM-C-HA)
16767026 500 ng

CPNE9 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details