Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sbmA (sbmA)

This Recombinant Protein sbmA (sbmA) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Protein sbmA

UniProt

P0AFY7

Expression Region

1-406

Origin

Escherichia coli O157:H7

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQIPISAARFWSLDFLIF YAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEVGVAVNAWYAPFYDLIQ TALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYVFRWRTAMNEYYMANWQQ LRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPVLVTLSAHVPELPIIGHIP YGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRKELVYGEDDATRATPPTVRE LFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFPSIVAGTITLGLMTQITNVFG QVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQEVTHTLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STARD5 Human Over-expression Lysate
orb1354656 100 µg

STARD5 Human Over-expression Lysate

Sign In for Pricing
View Details
Ammonium metavanadate
GRM1365-500G 1 unit

Ammonium metavanadate

Sign In for Pricing
View Details
PEDS1 Rabbit Polyclonal Antibody
TA382606 100 µL

PEDS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal CXCR3 Antibody (220803) [FITC]
FAB1685F 0.1 mL

Rat Monoclonal CXCR3 Antibody (220803) [FITC]

Sign In for Pricing
View Details
TAF7L CRISPR All-in-one AAV vector set (with saCas9)(Rat)
46091156 3x 1.0 µg DNA

TAF7L CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Anti-RUNX2 Antibody Picoband®, iFluor647 Conjugate
PA1224-iFluor647 100 µg

Anti-RUNX2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details