Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sbmA (sbmA)

This Recombinant Protein sbmA (sbmA) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Protein sbmA

UniProt

P0AFY7

Expression Region

1-406

Origin

Escherichia coli O157:H7

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQIPISAARFWSLDFLIF YAYYIVCVGLFALFWFIYSPHRWQYWSILGTALIIFVTWFLVEVGVAVNAWYAPFYDLIQ TALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYVFRWRTAMNEYYMANWQQ LRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPVLVTLSAHVPELPIIGHIP YGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRKELVYGEDDATRATPPTVRE LFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFPSIVAGTITLGLMTQITNVFG QVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQEVTHTLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ16 AAV Vector (Mouse) (CMV)
25380104 1 µg

KCNJ16 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Anti-ATP citrate lyase ACLY Antibody Picoband® (monoclonal, 5I2), HRP Conjugate
M02372-1-HRP 100 µg/Vial

Anti-ATP citrate lyase ACLY Antibody Picoband® (monoclonal, 5I2), HRP Conjugate

Sign In for Pricing
View Details
Insrr Mouse Gene Knockout Kit (CRISPR)
KN508365 1 Kit

Insrr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTEN (NM_000314) Human Mutant ORF Clone
RC400429 10 µg

PTEN (NM_000314) Human Mutant ORF Clone

Sign In for Pricing
View Details
Bovine IL5 ELISA Kit
E086631 1 Each

Bovine IL5 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-MAST4 Antibody
MBS4512589-01 0.05 mL

Rabbit anti-MAST4 Antibody

Sign In for Pricing
View Details