Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Vacuole membrane protein 1 (VMP1)

This Recombinant Pongo abelii Vacuole membrane protein 1 (VMP1) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Vacuole membrane protein 1, Transmembrane protein 49

UniProt

Q5R9K4

Expression Region

1-406

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAENGKNCDQRRVAMNKEQHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLE ILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGAHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEGGTEGTISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQG ENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF594 conjugate, 0.1mg/mL
BNC942312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF647 conjugate, 0.1mg/mL
BNC470195-500 1x 500 µL

CD66 (CEA) (C66/195), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF640R conjugate, 0.1mg/mL
BNC400501-100 1x 100 µL

Progesterone Receptor (PR501), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF488A conjugate, 0.1mg/mL
BNC882046-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF488A conjugate, 0.1mg/mL
BNC881389-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details