Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Endothelin-1 receptor (Ednra)

This Recombinant Rat Endothelin-1 receptor (Ednra) spans the amino acid sequence from region 21-426.

Product Specifications

Product Name Alternative

Endothelin-1 receptor, Endothelin A receptor, ET-A, ET-AR

UniProt

P26684

Expression Region

21-426

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALPSNGSMHGYCPQQTKITTAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL ITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCMLNATTKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSSHKDSMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPANXN2 Protein Vector (Human) (pPB-C-His)
PV132886 500 ng

SPANXN2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lef1 3'UTR GFP Stable Cell Line
TU257008 1.0 mL

Lef1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Giardia lamblia virus Major capsid protein (gag), partial
MBS1463405-01 0.02 mg (E-Coli)

Recombinant Giardia lamblia virus Major capsid protein (gag), partial

Sign In for Pricing
View Details
Recombinant Giardia lamblia virus Major capsid protein (gag), partial
MBS1463405-02 0.1 mg (E-Coli)

Recombinant Giardia lamblia virus Major capsid protein (gag), partial

Sign In for Pricing
View Details
Recombinant Giardia lamblia virus Major capsid protein (gag), partial
MBS1463405-03 1 mg (E-Coli)

Recombinant Giardia lamblia virus Major capsid protein (gag), partial

Sign In for Pricing
View Details
Recombinant Giardia lamblia virus Major capsid protein (gag), partial
MBS1463405-04 5x 1 mg (E-Coli)

Recombinant Giardia lamblia virus Major capsid protein (gag), partial

Sign In for Pricing
View Details