Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Endothelin-1 receptor (Ednra)

This Recombinant Rat Endothelin-1 receptor (Ednra) spans the amino acid sequence from region 21-426.

Product Specifications

Product Name Alternative

Endothelin-1 receptor, Endothelin A receptor, ET-A, ET-AR

UniProt

P26684

Expression Region

21-426

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALPSNGSMHGYCPQQTKITTAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL ITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCMLNATTKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSSHKDSMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM9 CRISPR Activation Plasmid (h2)
sc-403665-ACT-2 20 µg

ADAM9 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
UBE2E3, 1-207aa, Human, His tag, E Coli
MBS205967-01 0.02 mg

UBE2E3, 1-207aa, Human, His tag, E Coli

Sign In for Pricing
View Details
UBE2E3, 1-207aa, Human, His tag, E Coli
MBS205967-02 0.1 mg

UBE2E3, 1-207aa, Human, His tag, E Coli

Sign In for Pricing
View Details
UBE2E3, 1-207aa, Human, His tag, E Coli
MBS205967-03 5x 0.02 mg

UBE2E3, 1-207aa, Human, His tag, E Coli

Sign In for Pricing
View Details
UBE2E3, 1-207aa, Human, His tag, E Coli
MBS205967-04 0.5 mg

UBE2E3, 1-207aa, Human, His tag, E Coli

Sign In for Pricing
View Details
UBE2E3, 1-207aa, Human, His tag, E Coli
MBS205967-05 5x 0.1 mg

UBE2E3, 1-207aa, Human, His tag, E Coli

Sign In for Pricing
View Details