Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83)

This Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83) spans the amino acid sequence from region 18-423.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 83, Glucocorticoid-induced receptor

UniProt

P30731

Expression Region

18-423

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TEQPQVVTEHPSMEAALTGPNASSHFWANYTFSDWQNFVGRRRYGAESQNPTVKALLIVA YSFTIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTW VFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWVMA TFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYLLPLFIISV AYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVLFALCWFPLNCYVLLLSS KAIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALLSMCQRPPKPQEDRLPSP VPSFRVAWTEKSHGRRAPLPNHHLPSSQIQSGKTDLSSVEPVVAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYCSP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV759656 1.0 µg DNA

CYCSP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) PEX11-3 Polyclonal Antibody
MBS7188665 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) PEX11-3 Polyclonal Antibody

Sign In for Pricing
View Details
SMYD2 (F-9) : m-IgG1 BP-HRP Bundle
sc-544150 1 Kit

SMYD2 (F-9) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Cadherin 7 (CDH7) (NM_004361) Human Over-expression Lysate
E45H19003-2 20 µg

Cadherin 7 (CDH7) (NM_004361) Human Over-expression Lysate

Sign In for Pricing
View Details
A-770041 25mg
A11288-25 25 mg

A-770041 25mg

Sign In for Pricing
View Details
Lentiviral human MICAL1 shRNA (UAS) - Lentiviral human MICAL1 shRNA (UAS, GFP) plasmid
GTR15128266 1 Vial

Lentiviral human MICAL1 shRNA (UAS) - Lentiviral human MICAL1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details