Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83)

This Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83) spans the amino acid sequence from region 18-423.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 83, Glucocorticoid-induced receptor

UniProt

P30731

Expression Region

18-423

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TEQPQVVTEHPSMEAALTGPNASSHFWANYTFSDWQNFVGRRRYGAESQNPTVKALLIVA YSFTIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTW VFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWVMA TFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYLLPLFIISV AYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVLFALCWFPLNCYVLLLSS KAIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALLSMCQRPPKPQEDRLPSP VPSFRVAWTEKSHGRRAPLPNHHLPSSQIQSGKTDLSSVEPVVAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM41 (NM_033549) Human Tagged Lenti ORF Clone
RC210557L1 10 µg

TRIM41 (NM_033549) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Dengue NS1 Antigen
DNS-125 1 Vial

Recombinant Dengue NS1 Antigen

Sign In for Pricing
View Details
Human/Mouse Cathepsin B MAb (Clone 173317)
MAB965 500 µg

Human/Mouse Cathepsin B MAb (Clone 173317)

Sign In for Pricing
View Details
Anti-CXCR2 antibody
STJ13100105 100 µl

Anti-CXCR2 antibody

Sign In for Pricing
View Details
LOC100360148 3'UTR GFP Stable Cell Line
TU257459 1.0 mL

LOC100360148 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
(Z) -Guggulsterone 100mg
A19901-100 100 mg

(Z) -Guggulsterone 100mg

Sign In for Pricing
View Details