Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83)

This Recombinant Mouse Probable G-protein coupled receptor 83 (Gpr83) spans the amino acid sequence from region 18-423.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 83, Glucocorticoid-induced receptor

UniProt

P30731

Expression Region

18-423

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TEQPQVVTEHPSMEAALTGPNASSHFWANYTFSDWQNFVGRRRYGAESQNPTVKALLIVA YSFTIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTW VFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWVMA TFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYLLPLFIISV AYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVLFALCWFPLNCYVLLLSS KAIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALLSMCQRPPKPQEDRLPSP VPSFRVAWTEKSHGRRAPLPNHHLPSSQIQSGKTDLSSVEPVVAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)
MBS6394957-01 0.1 mL

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)

Sign In for Pricing
View Details
SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)
MBS6394957-02 5x 0.1 mL

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)

Sign In for Pricing
View Details
N4bp2l2 Mouse qPCR Primer Pair (NM_201369)
MP208727 200 Reactions

N4bp2l2 Mouse qPCR Primer Pair (NM_201369)

Sign In for Pricing
View Details
Mouse Anti-TF Recombinant Antibody (clone 5A4)
ZG-0139C Each

Mouse Anti-TF Recombinant Antibody (clone 5A4)

Sign In for Pricing
View Details
ABHD14A Antibody
MBS8501771-01 0.1 mg

ABHD14A Antibody

Sign In for Pricing
View Details
ABHD14A Antibody
MBS8501771-02 0.1 mL (AF405L)

ABHD14A Antibody

Sign In for Pricing
View Details