Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 64b (Gr64b)

This Recombinant Drosophila melanogaster Putative gustatory receptor 64b (Gr64b) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Putative gustatory receptor 64b

UniProt

P83294

Expression Region

1-406

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQGETFHRAVSNVLFISQIYGLLPVSNVRALDVADIRFRWCSPRILYSLLIGILNLSEF GAVINYVIKVTINFHTSSTLSLYIVCLLEHLFFWRLAIQWPRIMRTWHGVEQLFLRVPYR FYGEYRIKRRIYIVFTIVMSSALVEHCLLLGNSFHLSNMERTQCKINVTYFESIYKWERP HLYMILPYHFWMLPILEWVNQTIAYPRSFTDCFIMCIGIGLAARFHQLYRRIAAVHRKVM PAVFWTEVREHYLALKRLVHLLDAAIAPLVLLAFGNNMSFICFQLFNSFKNIGVDFLVML AFWYSLGFAVVRTLLTIFVASSINDYERKIVTALRDVPSRAWSIEVQRFSEQLGNDTTAL SGSGFFYLTRSLVLAMGTTIITYELMISDVINQGSIRQKTQYCREY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF594 conjugate, 0.1mg/mL
BNC941194-500 1x 500 µL

EGFR (31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL
BNC680690-100 1x 100 µL

TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (2H11 + 6E1), CF568 conjugate, 0.1mg/mL
BNC680724-500 1x 500 µL

Thyroglobulin (2H11 + 6E1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details