Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Corticotropin-releasing factor receptor 2 (Crhr2)

This Recombinant Mouse Corticotropin-releasing factor receptor 2 (Crhr2) spans the amino acid sequence from region 25-431.

Product Specifications

Product Name Alternative

Corticotropin-releasing factor receptor 2, CRF-R-2, CRF-R2, CRFR-2, CRF-RB, Corticotropin-releasing hormone receptor 2, CRH-R-2, Sh

UniProt

Q60748

Expression Region

25-431

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VAQPGQAPQDQPLWTLLEQYCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPC PEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGH CVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWC RCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAV GKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSETIQ YRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNG EVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BmiI, 400U
RV1152 400 U

BmiI, 400U

Sign In for Pricing
View Details
CTDSP1 (NM_182642) Human Over-expression Lysate
LY403640 100 µg

CTDSP1 (NM_182642) Human Over-expression Lysate

Sign In for Pricing
View Details
PceI, 25 preps
FDRE1308 25 Preparations

PceI, 25 preps

Sign In for Pricing
View Details
WDR79 (WRAP53) Human Gene Knockout Kit (CRISPR)
KN200142 1 Kit

WDR79 (WRAP53) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bovine Aldehyde Oxidase 1 (AOX1) ELISA Kit
RD-AOX1-b-01 96 Tests

Bovine Aldehyde Oxidase 1 (AOX1) ELISA Kit

Sign In for Pricing
View Details
Bovine Aldehyde Oxidase 1 (AOX1) ELISA Kit
RD-AOX1-b-02 48 Tests

Bovine Aldehyde Oxidase 1 (AOX1) ELISA Kit

Sign In for Pricing
View Details