Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Corticotropin-releasing factor receptor 2 (Crhr2)

This Recombinant Mouse Corticotropin-releasing factor receptor 2 (Crhr2) spans the amino acid sequence from region 25-431.

Product Specifications

Product Name Alternative

Corticotropin-releasing factor receptor 2, CRF-R-2, CRF-R2, CRFR-2, CRF-RB, Corticotropin-releasing hormone receptor 2, CRH-R-2, Sh

UniProt

Q60748

Expression Region

25-431

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VAQPGQAPQDQPLWTLLEQYCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPC PEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGH CVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWC RCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAV GKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSETIQ YRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNG EVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf49 (NM_001003677) Human Over-expression Lysate
LC424097 20 µg

C11orf49 (NM_001003677) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTPRN (NM_002846) Human Over-expression Lysate
LY419074 100 µg

PTPRN (NM_002846) Human Over-expression Lysate

Sign In for Pricing
View Details
EMA (MUC1) (NM_001018016) Human Recombinant Protein
TP321390L 1 mg

EMA (MUC1) (NM_001018016) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB523232 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Klf15 Mouse Gene Knockout Kit (CRISPR)
KN308828BN 1 Kit

Klf15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details