Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Endothelin-1 receptor (EDNRA)

This Recombinant Sheep Endothelin-1 receptor (EDNRA) spans the amino acid sequence from region 21-427.

Product Specifications

Product Name Alternative

Endothelin-1 receptor, Endothelin A receptor, ET-A, ET-AR

UniProt

Q95L55

Expression Region

21-427

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DNPESYSTNLSIHVDSVTTFRGTELSFVVTTHQPTNLALPSNGSMHNYCPQQTKITSAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFEQNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL VTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGAQHRTCMLNATSKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDTNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCYQSKSLMTSVPMNGTSIQWKNPEQNNHNTERSSHKDSIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SUV39H2 Antibody [Alexa Fluor 594]
NBP2-98968AF594 0.1 mL

Rabbit Polyclonal SUV39H2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
IRF4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-54718R-BF680 100 µL

IRF4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit anti GFP-Tag mAb (AMR11686N)
AMR11686N-01 50 µL

Rabbit anti GFP-Tag mAb (AMR11686N)

Sign In for Pricing
View Details
Rabbit anti GFP-Tag mAb (AMR11686N)
AMR11686N-02 100 µL

Rabbit anti GFP-Tag mAb (AMR11686N)

Sign In for Pricing
View Details
Rabbit anti GFP-Tag mAb (AMR11686N)
AMR11686N-03 200 µL

Rabbit anti GFP-Tag mAb (AMR11686N)

Sign In for Pricing
View Details
KRT8P23 Recombinant Protein (Human)
RP067401 100 µg

KRT8P23 Recombinant Protein (Human)

Sign In for Pricing
View Details