Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Endothelin-1 receptor (EDNRA)

This Recombinant Sheep Endothelin-1 receptor (EDNRA) spans the amino acid sequence from region 21-427.

Product Specifications

Product Name Alternative

Endothelin-1 receptor, Endothelin A receptor, ET-A, ET-AR

UniProt

Q95L55

Expression Region

21-427

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DNPESYSTNLSIHVDSVTTFRGTELSFVVTTHQPTNLALPSNGSMHNYCPQQTKITSAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFEQNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL VTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGAQHRTCMLNATSKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDTNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCYQSKSLMTSVPMNGTSIQWKNPEQNNHNTERSSHKDSIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP13 antibody
70R-9735 50 ug

USP13 antibody

Sign In for Pricing
View Details
AFP Recombinant Protein
OPCD01172-50UG 50 µg

AFP Recombinant Protein

Sign In for Pricing
View Details
Caspase 1 Antibody
E18-5418-1 50 µg - 50 µL

Caspase 1 Antibody

Sign In for Pricing
View Details
16-Phenylhexadecanoic acid
sc-258975A 200 mg

16-Phenylhexadecanoic acid

Sign In for Pricing
View Details
Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit
MBS1603419-01 48 Well

Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit

Sign In for Pricing
View Details
Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit
MBS1603419-02 96 Well

Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit

Sign In for Pricing
View Details