Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 83 (GPR83)

This Recombinant Human Probable G-protein coupled receptor 83 (GPR83) spans the amino acid sequence from region 17-423.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 83, G-protein coupled receptor 72

UniProt

Q9NYM4

Expression Region

17-423

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRRYGAESQNPTVKALLIV AYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNST WIFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWTM ATFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYILPLLIIS VAYARVAKKLWLCNMIGDVTTEQYFALRRKKKKTIKMLMLVVVLFALCWFPLNCYVLLLS SKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALLSMCQRPPKPQEDRPPS PVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIVTMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZSCAN23 activation kit by CRISPRa
GA116682 1 Kit

Human ZSCAN23 activation kit by CRISPRa

Sign In for Pricing
View Details
RALY (Center) Rabbit Polyclonal Antibody
AP53572PU-N 400 µL

RALY (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Recombinant PUMA Antibody
RC-17018-01 50 μL

Recombinant PUMA Antibody

Sign In for Pricing
View Details
Recombinant PUMA Antibody
RC-17018-02 100 µL

Recombinant PUMA Antibody

Sign In for Pricing
View Details