Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 83 (GPR83)

This Recombinant Human Probable G-protein coupled receptor 83 (GPR83) spans the amino acid sequence from region 17-423.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 83, G-protein coupled receptor 72

UniProt

Q9NYM4

Expression Region

17-423

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRRYGAESQNPTVKALLIV AYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNST WIFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWTM ATFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYILPLLIIS VAYARVAKKLWLCNMIGDVTTEQYFALRRKKKKTIKMLMLVVVLFALCWFPLNCYVLLLS SKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALLSMCQRPPKPQEDRPPS PVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIVTMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA6 (NM_002490) Human Over-expression Lysate
LC419290 20 µg

NDUFA6 (NM_002490) Human Over-expression Lysate

Sign In for Pricing
View Details
Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]
CL007A 1 mg

Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), 1mg/mL
BNUM1824-50 1x 50 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), 1mg/mL

Sign In for Pricing
View Details
Recombinant Rabbit IL10 protein (His tag)
PDMO100002-01 20 µg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rabbit IL10 protein (His tag)
PDMO100002-02 100 µg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rabbit IL10 protein (His tag)
PDMO100002-03 500 µg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details