Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azoarcus sp. UPF0761 membrane protein azo3165 (azo3165)

This Recombinant Azoarcus sp. UPF0761 membrane protein azo3165 (azo3165) spans the amino acid sequence from region 1-408.

Product Specifications

Product Name Alternative

UPF0761 membrane protein azo3165

UniProt

A1KAC6

Expression Region

1-408

Origin

Azoarcus sp. (strain BH72)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLHPTRDFLRLLGERFSATRCPQVAGSLAFTTLLALVPLLTVAIGVFGNLPGMDKLGAS LKDFLLENLLPDRAGRIITTYALQFSQKAARLTLIGTAMLAVTALMLLATIERVFNQIWG VRHRRPLLMRITVSWFMLTLGPVILGGSVVATGYLVSTSAEWSDRLPWIGEIAAATLPPL LLGALFSFLYYAVPNHPVRLLHALAGGLCAALVFLLMQRGLGLFIAGFPTYTLIYGTFAA LPIFLLWLYLSWTVILLGALITATLPAFLERQRMLPAFPGDRAWAAVEMLAALAEAQYDG RPVGFAALRRRTNLAEHAAEALLESLRECGIASRTEGGDWVLTRAASDIRLSAVLQRFAL DLTAWSALSPGRGGRIVAERLREGLQAADLSLAELAAANTSAGAVQVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-100 1x 100 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (TRP/816), CF647 conjugate, 0.1mg/mL
BNC470816-500 1x 500 µL

P53 (TRP/816), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF594 conjugate, 0.1mg/mL
BNC941991-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF647 conjugate, 0.1mg/mL
BNC471526-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details