Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Alpha-2Da adrenergic receptor (adra2da)

This Recombinant Danio rerio Alpha-2Da adrenergic receptor (adra2da) spans the amino acid sequence from region 1-408.

Product Specifications

Product Name Alternative

Alpha-2Da adrenergic receptor, Alpha-2Da adrenoceptor, Alpha (2Da) AR, Alpha-2Da adrenoreceptor

UniProt

Q8JG70

Expression Region

1-408

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVTPTANSTEEAANITASPRLWPYTEPASAIIILVVSLIILLTIVGNVLVIVAVLTSRA LRAPQNLFLVSLACADILVATLVIPFSLANEIMGYWYFGSTWCAFYLALDVLFCTSSIVH LCAISLDRYWSVTKAVRYNLKRTPRRIKCMIAVVWLISAVISFPPLIMTKHDEKECLIND ETWYILSSCAVSFFAPGLIMITVYCKIYRVAKQRSSTVFVAKNGLERQPSQSETCFVRKD KFEKESPSSNSSESAQRQEELDDIDLEESAASDSRARGSRFSKRRRVEGERRGPQRSCRV SWAAHQEPGSRQQQLASKSKVAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSLQAVCGER CGPPEALFKLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKVVCWSAQRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGRP (CALCB) Rabbit Polyclonal Antibody
TA364047 50 µL

CGRP (CALCB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Chloroprionaldehyde Diethyl Acetal, Technical grade (Stabilized)
TRC-C379795-5ML 5 mL

3-Chloroprionaldehyde Diethyl Acetal, Technical grade (Stabilized)

Sign In for Pricing
View Details
Caspase 2 (CASP2) (C-term) Rabbit Polyclonal Antibody
AP23372PU-N 100 µg

Caspase 2 (CASP2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ST2 Mouse Monoclonal Antibody [PSH01-68]
HA601170 100 µL

ST2 Mouse Monoclonal Antibody [PSH01-68]

Sign In for Pricing
View Details
ZNF619 Human Gene Knockout Kit (CRISPR)
KN427136 1 Kit

ZNF619 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PEDF (SERPINF1) (NM_002615) Human Recombinant Protein
TP720443L 500 µg

PEDF (SERPINF1) (NM_002615) Human Recombinant Protein

Sign In for Pricing
View Details