Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Alpha-2Da adrenergic receptor (adra2da)

This Recombinant Danio rerio Alpha-2Da adrenergic receptor (adra2da) spans the amino acid sequence from region 1-408.

Product Specifications

Product Name Alternative

Alpha-2Da adrenergic receptor, Alpha-2Da adrenoceptor, Alpha (2Da) AR, Alpha-2Da adrenoreceptor

UniProt

Q8JG70

Expression Region

1-408

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVTPTANSTEEAANITASPRLWPYTEPASAIIILVVSLIILLTIVGNVLVIVAVLTSRA LRAPQNLFLVSLACADILVATLVIPFSLANEIMGYWYFGSTWCAFYLALDVLFCTSSIVH LCAISLDRYWSVTKAVRYNLKRTPRRIKCMIAVVWLISAVISFPPLIMTKHDEKECLIND ETWYILSSCAVSFFAPGLIMITVYCKIYRVAKQRSSTVFVAKNGLERQPSQSETCFVRKD KFEKESPSSNSSESAQRQEELDDIDLEESAASDSRARGSRFSKRRRVEGERRGPQRSCRV SWAAHQEPGSRQQQLASKSKVAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSLQAVCGER CGPPEALFKLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKVVCWSAQRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Napsin-A (NAPSA/1238), CF568 conjugate, 0.1mg/mL
BNC681238-100 1x 100 µL

Napsin-A (NAPSA/1238), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Medronic Acid
TRC-M203500-50MG 50 mg

Medronic Acid

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL
BNC742094-100 1x 100 µL

P53 Tumor Suppressor Protein (rBP53-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Formylphenylboronic Acid
TRC-F700970-5G 5 g

3-Formylphenylboronic Acid

Sign In for Pricing
View Details
Human DYNLT5 activation kit by CRISPRa
GA116334 1 Kit

Human DYNLT5 activation kit by CRISPRa

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), 1mg/mL
BNUM0014-50 1x 50 µL

CD31 / PECAM-1 (C31.7), 1mg/mL

Sign In for Pricing
View Details