Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oncorhynchus mykiss Beta-2 adrenergic receptor (adrb2)

This Recombinant Oncorhynchus mykiss Beta-2 adrenergic receptor (adrb2) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q8UUY8

Expression Region

1-409

Origin

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVSTPAVFNLSDLSVEMNSSSRQWSYSEYSEAVAVLLGILMALLVMCIVFGNVLVITA IVRFQRLQTVTNMFITSLACADLVMGLLVVPFGACYILLNTWHFGSFLCEFWTAADVLCV TASIETLCVIALDRYLAITSPLRYPSLLTKRKACVVVVTVWGVAALISFLPIHMKWWVSD EPEALSCLEDAHCCDFNTNAAYAVASSVVSFYIPLAVMAFVYGRVFQEARKQLEKIRGSE GRFHAQMIDNNQGQDGGDGSGGGGGNGKRPKFCLKEHKALKTLGIIMGTFTLCWLPFFVL NVVVTIWKVDNIKMPFRILNWIGYANSAFNPLIYCRSPEFRYAFQEILCLRGAAFPTNGY IYRGHSLRLSPKDKPGSLSNNVGTVELGSLSSVTNINGYCNNPPLASIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-100 1x 100 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
BNC681037-500 1x 500 µL

CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF405S conjugate, 0.1mg/mL
BNC042460-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details