Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Adenosine receptor A2a (ADORA2A)

This Recombinant Guinea pig Adenosine receptor A2a (ADORA2A) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

Adenosine receptor A2a

UniProt

P46616

Expression Region

1-409

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSSVYITVELVIAVLAILGNVLVCWAVWINSNLQNVTNYFVVSLAAADIAVGVLAIPFA ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLTITIDRYIAIRIPLRYNGLVTCTRAKG IIAICWVLSFAIGLTPMLGWNNCSQPKGDKNHSESCDEGQVTCLFEDVVPMNYMVYYNFF AFVLVPLLLMLGIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHPAKSLAIIVGLFA LCCLPLNIINCFTFFCPECDHAPPWLMYLTIILSHGNSVVNPLIYAYRIREFRQTFRKII RSHILRRRELFKAGGTSARASAAHSPEGEQVSLRLNGHPPGVWANGSALRPEQRPNGYVL GLVSGRSAQRSHGDASLSDVELLSHEHKGTCPESPSLEDPPAHGGAGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX5 Rabbit Polyclonal Antibody (HRP)
orb2137063 100 µL

SOX5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Porcine E3 Estriol ELISA Kit
MBS734141-01 48 Well

Porcine E3 Estriol ELISA Kit

Sign In for Pricing
View Details
Porcine E3 Estriol ELISA Kit
MBS734141-02 96 Well

Porcine E3 Estriol ELISA Kit

Sign In for Pricing
View Details
Porcine E3 Estriol ELISA Kit
MBS734141-03 5x 96 Well

Porcine E3 Estriol ELISA Kit

Sign In for Pricing
View Details
Porcine E3 Estriol ELISA Kit
MBS734141-04 10x 96 Well

Porcine E3 Estriol ELISA Kit

Sign In for Pricing
View Details
MAP2 antibody
20R-2857 100 µL

MAP2 antibody

Sign In for Pricing
View Details