Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adenosine receptor A2a (Adora2a)

This Recombinant Mouse Adenosine receptor A2a (Adora2a) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Adenosine receptor A2a

UniProt

Q60613

Expression Region

1-410

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSSVYIMVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGMRAKG IIAICWVLSFAIGLTPMLGWNNCSQKDENSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC WLPLHIINCFTFFCSTCQHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT HVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSAPHSGRRPNGYTLGP GGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVGTASWSSEFAPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scavenger Receptor BII Antibody, PE Conjugated
bs-7545R-PE 100 µL

Scavenger Receptor BII Antibody, PE Conjugated

Sign In for Pricing
View Details
PRDX5 Antibody
orb1327180 100 µg

PRDX5 Antibody

Sign In for Pricing
View Details
C1orf210 sgRNA CRISPR Lentivector (Human) (Target 2)
K0217903 1.0 µg DNA

C1orf210 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Brucella suis Histidine--tRNA ligase (hisS), partial
MBS1061148 Inquire

Recombinant Brucella suis Histidine--tRNA ligase (hisS), partial

Sign In for Pricing
View Details
Recombinant Human ANXA1 Protein
MBS8248539-01 0.01 mg

Recombinant Human ANXA1 Protein

Sign In for Pricing
View Details
Recombinant Human ANXA1 Protein
MBS8248539-02 0.05 mg

Recombinant Human ANXA1 Protein

Sign In for Pricing
View Details