Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adenosine receptor A2a (Adora2a)

This Recombinant Mouse Adenosine receptor A2a (Adora2a) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Adenosine receptor A2a

UniProt

Q60613

Expression Region

1-410

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSSVYIMVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGMRAKG IIAICWVLSFAIGLTPMLGWNNCSQKDENSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC WLPLHIINCFTFFCSTCQHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT HVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSAPHSGRRPNGYTLGP GGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVGTASWSSEFAPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type (deoD)
CSB-EP364680ENVe0-01 20 µg

Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type (deoD)
CSB-EP364680ENVe0-02 100 µg

Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type (deoD)
CSB-EP364680ENVe0-03 1 mg

Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) mhpF Polyclonal Antibody
MBS7178043 Inquire

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) mhpF Polyclonal Antibody

Sign In for Pricing
View Details
TIMP3 Antibody
CSB-PA834137-01 50 μL

TIMP3 Antibody

Sign In for Pricing
View Details
TIMP3 Antibody
CSB-PA834137-02 100 µL

TIMP3 Antibody

Sign In for Pricing
View Details