Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurotensin receptor type 2 (NTSR2)

This Recombinant Human Neurotensin receptor type 2 (NTSR2) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Neurotensin receptor type 2, NT-R-2, NTR2, Levocabastine-sensitive neurotensin receptor

UniProt

O95665

Expression Region

1-410

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKA RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified
MBS3905302-01 0.01 mg

Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified
MBS3905302-02 0.1 mg

Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified
MBS3905302-03 5x 0.01 mg

Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified
MBS3905302-04 5x 0.1 mg

Rabbit anti-PAPD5/TRF4-2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Hyaluronic Acid ELISA Kit, 96 tests, Quantitative
10850 1 Kit

Hyaluronic Acid ELISA Kit, 96 tests, Quantitative

Sign In for Pricing
View Details
Mouse CD1 Brain, whole Total Protein
MT-201 1 mg

Mouse CD1 Brain, whole Total Protein

Sign In for Pricing
View Details