Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurotensin receptor type 2 (NTSR2)

This Recombinant Human Neurotensin receptor type 2 (NTSR2) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Neurotensin receptor type 2, NT-R-2, NTR2, Levocabastine-sensitive neurotensin receptor

UniProt

O95665

Expression Region

1-410

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKA RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACR3 ELISA Kit (Human) (OKEH02421)
OKEH02421 96 Well

TACR3 ELISA Kit (Human) (OKEH02421)

Sign In for Pricing
View Details
PON1 Recombinant Antibody, Cy5.5 Conjugated
bsm-62942R-Cy5.5 100 µL

PON1 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
GENLISA Canine Surfactant Associated Protein A2 (SPA2) ELISA
KLN0869 1x 96 Well

GENLISA Canine Surfactant Associated Protein A2 (SPA2) ELISA

Sign In for Pricing
View Details
M6PR (Cation-dependent Mannose-6-phosphate Receptor, CD Man-6-P Receptor, CD-MPR, 46kD Mannose 6-phosphate Receptor, MPR 46, MPR46, MPRD)
M2255-17E 100 µg

M6PR (Cation-dependent Mannose-6-phosphate Receptor, CD Man-6-P Receptor, CD-MPR, 46kD Mannose 6-phosphate Receptor, MPR 46, MPR46, MPRD)

Sign In for Pricing
View Details
BTD (Biotinidase) (MaxLight 650)
MBS6445301-01 0.1 mL

BTD (Biotinidase) (MaxLight 650)

Sign In for Pricing
View Details
BTD (Biotinidase) (MaxLight 650)
MBS6445301-02 5x 0.1 mL

BTD (Biotinidase) (MaxLight 650)

Sign In for Pricing
View Details