Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Adenosine receptor A2a (ADORA2A)

This Recombinant Horse Adenosine receptor A2a (ADORA2A) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Adenosine receptor A2a

UniProt

Q6TLI7

Expression Region

1-412

Origin

Equus caballus (Horse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTVGSLVYIMVELAIALLAILGNMLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGVIAVCWVLSFAIGLTPMLGWNNCHHWGEGENQSQGCGEGQVACLFEDVVPMNYMVYY NFFACVLVPLLLMLGVYLRIFLAARRQLKQMETQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPECPHAPLWLMYPAIILSHFNSVVNPFIYAYRIREFRHTFH KIIRSHILRRQEPFKAGGTSARALAAHGSDAEQVSLRLNGHPSGVCPNGSAPHPERRPNG YALGLVSRASARESPGDTGLPDVELLSHELHGASPESPGLEGPLAQDGAGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Porcine S100A12 protein (His tag)
PDEP100011-01 20 µg

Recombinant Porcine S100A12 protein (His tag)

Sign In for Pricing
View Details
Recombinant Porcine S100A12 protein (His tag)
PDEP100011-02 100 µg

Recombinant Porcine S100A12 protein (His tag)

Sign In for Pricing
View Details
Recombinant Porcine S100A12 protein (His tag)
PDEP100011-03 500 µg

Recombinant Porcine S100A12 protein (His tag)

Sign In for Pricing
View Details
Recombinant Porcine S100A12 protein (His tag)
PDEP100011-04 1 mg

Recombinant Porcine S100A12 protein (His tag)

Sign In for Pricing
View Details
Neurofilament (H+L) (Neuronal Marker) (2F11), CF568 conjugate, 0.1mg/mL
BNC683912-100 1x 100 µL

Neurofilament (H+L) (Neuronal Marker) (2F11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Matriptase 2 (TMPRSS6) Human Gene Knockout Kit (CRISPR)
KN212708BN 1 Kit

Matriptase 2 (TMPRSS6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details